PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002914
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family LBD
Protein Properties Length: 194aa    MW: 21128.8 Da    PI: 8.7999
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-7238PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.55.6e-4410108199
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                +CaaCk+lrrkC ++C++apyfp e+p+kf nvhklFGasnv+kll+++++++red+++sl yeAear+rdPvyG+vg+i+ lq+q++ l+++l+++k+
  Lsa002914  10 PCAACKFLRRKCMPGCTFAPYFPPEDPQKFVNVHKLFGASNVTKLLSEVQPHQREDVVNSLSYEAEARVRDPVYGCVGIISILQRQIDVLQKDLDAAKA 108
                7*********************************************************************************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.1069110IPR004883Lateral organ boundaries, LOB
PfamPF031954.7E-4310107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MASSSSCNSP CAACKFLRRK CMPGCTFAPY FPPEDPQKFV NVHKLFGASN VTKLLSEVQP  60
HQREDVVNSL SYEAEARVRD PVYGCVGIIS ILQRQIDVLQ KDLDAAKADL MRYARNATPV  120
MPHLSSIQPA TSQHRTIDHF SAKRIGGLYQ PPPPFPNPYA NRQWNSYNSF NSRENLSGGG  180
SGGAGGGVSG EGNI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007036350.15e-77Lateral organ boundaries domain family protein
SwissprotQ9FML42e-63LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A103XWK08e-82A0A103XWK0_CYNCS; Lateral organ boundaries domain-containing protein
STRINGPOPTR_0015s09370.12e-72(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-57LBD family protein